• Product NameRecombinant rat Interleukin-18 protein
• Brief DescriptionRecombinant Protein
• Host SpeciesE.coli
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:37-194aa
  Sequence Info:Full Length
• Alternative Names    Interferon gamma-inducing factor ;IFN-gamma-inducing factorInterleukin-1 gamma ;IL-1 gamma
• Accession No. P97636
• UniprotP97636
• Gene ID29197;
• Calculated MW 22.3 kDa
• Tag Info N-terminal 6xHis-tagged
• Target Sequence HFGRLHCTTAVIRSINDQVLFVDKRNPPVFEDMPDIDRTANESQTRLIIYMYKDSEVRGLAVTLSVKDGRMSTLSCKNKIISFEEMNPPENIDDIKSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLVLKRKDENGDKSVMFTLTNLHQS
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Augments natural killer cell activity in spleen cells and stimulates interferon gamma production in T-helper type I cells.

Cloning of the cDNA for interleukin-18 in PC12 and expression in Escherichia coli.Kim S.-J., Kim C.-S., Song K.-Y., Kim J.-S., Jung K.-S. IL-18 translational inhibition restricts IFN-gamma expression in crescentic glomerulonephritis.Garcia G.E., Xia Y., Ku G., Johnson R.J., Wilson C.B., Feng L.Kidney Int. 64:160-169(2003)
Research Topic:Others

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting