- Product NameRecombinant human Zinc transporter ZIP1 protein
- Brief DescriptionRecombinant Protein
- Host SpeciesE.coli
- PurificationGreater than 90% as determined by SDS-PAGE.
- Immunogen DescriptionExpression Region:126-179aa
Sequence Info:Cytoplasmic Domain - Alternative Names Solute carrier family 39 member 1Zinc-iron-regulated transporter-likeZrt- and Irt-like protein 1 ;ZIP-1 ;hZIP1
- Accession No. Q9NY26
- UniprotQ9NY26
- Gene ID27173;
- Calculated MW 9.6 kDa
- Tag Info N-terminal 6xHis-tagged
- Target Sequence MEQITLAYKEQSGPSPLEETRALLGTVNGGPQHWHDGPGVPQASGAPATPSALR
- Formulation Tris-based buffer50% glycerol
-
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.