• Product NameRecombinant bovine Apolipoprotein A-I
• Brief DescriptionRecombinant Protein
• Host SpeciesYeast
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:25-265aa
  Sequence Info:Full Length
• Alternative Names    Apolipoprotein A1
• Accession No. P15497
• UniprotP15497
• Gene ID281631;
• Calculated MW 29.5 kDa
• Tag Info N-terminal 6xHis-tagged
• Target Sequence DDPQSSWDRVKDFATVYVEAIKDSGRDYVAQFEASALGKQLNLKLLDNWDTLASTLSKVREQLGPVTQEFWDNLEKETASLRQEMHKDLEEVKQKVQPYLDEFQKKWHEEVEIYRQKVAPLGEEFREGARQKVQELQDKLSPLAQELRDRARAHVETLRQQLAPYSDDLRQRLTARLEALKEGGGSLAEYHAKASEQLKALGEKAKPVLEDLRQGLLPVLESLKVSILAAIDEASKKLNAQ
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Participates in the reverse transport of cholesterol from tissues to the liver for excretion by promoting cholesterol efflux from tissues and by acting as a cofactor for the lecithin cholesterol acyltransferase (LCAT). As part of the SPAP complex, activates spermatozoa motility.

Characterization and amino-terminal sequence of apolipoprotein AI from plasma high density lipoproteins in the preruminant calf, Bos spp.Auboiron S., Sparrow D.A., Beaubatie L., Bauchart D., Sparrow J.T., Laplaud M.P., Chapman J.M.Biochem. Biophys. Res. Commun. 166:833-839(1990)
Research Topic:Others

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting