• Product NameRecombinant Rattus norvegicus Basic leucine zipper transcriptional factor ATF-like 3
• Brief DescriptionRecombinant Protein
• Host SpeciesYeast
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:1-133aa
  Sequence Info:Full Length
• Alternative Names    Jun dimerization protein 1 ;JDP-1
• Accession No. P97876
• UniprotP97876
• Gene ID60462;
• Calculated MW 17.1 kDa
• Tag Info N-terminal 6xHis-tagged
• Target Sequence MSQGPPAGGVLQSSVAAPGNQPQSPKDDDRKVRRREKNRVAAQRSRKKQTQKSDKLHEEHESLEQENSVLRREIAKLKEELRHLTEALKEHEKMCPLLLCPMNFVQLRPDPVASWSAHDAPDHPSFIWLGTLV
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

AP-1 family transcription factor that controls the differentiation of CD8+ thymic conventional dendritic cells in the immune syst. Acts via the formation of a heterodimer with JUN family proteins that recognizes and binds DNA sequence 5'-TGA[CG]TCA-3' and regulates expression of target genes. Required for development of CD8-alpha+ classical dendritic cells (cDCs) and related CD103+ dendritic cells that cross-present antigens to CD8 T-cells and produce interleukin-12 (IL12) in response to pathogens .

Isolation of an AP-1 repressor by a novel method for detecting protein-protein interactions.Aronheim A., Zandi E., Hennemann H., Elledge S.J., Karin M.Mol. Cell. Biol. 17:3094-3102(1997)
Research Topic:Others

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting