- Product NameRecombinant Human Insulin-Like Growth Factor I,IGF-I,IGF1
- Host SpeciesE.coli
- PurificationGreater than 95% as determined by reducing SDS-PAGE.
- SpecificityHuman
- EndotoxinLess than 0.05 ng,μg (0.5 IEU,μg) as determined by LAL test.
- Accession No. P05019
- UniprotP05019
- Gene ID3479;
- Calculated MW 7.6kDa
- Target Sequence GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
- Formulation Lyophilized from a 0.2 μm filtered solution of 300mM NaAc, pH 6.5.
-
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg,ml.
Dissolve the lyophilized protein in 500mM Acetic Acid.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. -
Storage Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20C for 3 months.
