- Product NameRecombinant Mouse Interleukin-1α,IL-1α
- Host SpeciesE.coli
- PurificationGreater than 95% as determined by reducing SDS-PAGE.
- SpecificityMouse
- EndotoxinLess than 0.1 ng,μg (1 IEU,μg) as determined by LAL test.
- Accession No. P01582
- UniprotP01582
- Gene ID16175;
- Calculated MW 18kDa
- Target Sequence SAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS
- Formulation Lyophilized from a 0.2 μm filtered solution of 50mM TrisHCl, 200mM NaCl, pH 8.0.
-
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg,ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. -
Storage Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20C for 3 months.
