- Product NameRecombinant Human ADAM-like Protein Decysin-1,ADAMDEC1 (C-6His)
- Host SpeciesHuman Cells
- PurificationGreater than 95% as determined by reducing SDS-PAGE.
- SpecificityHuman
- EndotoxinLess than 0.1 ng,μg (1 IEU,μg) as determined by LAL test.
- Accession No. O15204
- UniprotO15204
- Gene ID27299;
- Calculated MW 30.3kDa
- Target Sequence KSPEKEDFLRAQKYIDLYLVLDNAFYKNYNENLTLIRSFVFDVMNLLNVIYNTIDVQVALVGMEIWSDGDKIKVVPSASTTFDNFLRWHSSNLGKKIHDHAQLLSGISFNNRRVGLAASNSLCSPSSVAVIEAKKKNNVALVGVMSHELGHVLGMPDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCLLQAPIPTNIMTTPVCGNHLLEVGEDCDCGSPKECTNLCCEALTCKLKPGTDCGGDAPNHTTEVDHHHHHH
- Formulation Supplied as a 0.2 μm filtered solution of 20mM TrisHCl,150mM NaCl,1mM ZnCl2,pH7.5.
-
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg,ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. -
Storage Store at < -20C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.