- Product NameRecombinant Human NEDD8-Conjugating Enzyme UBC12,UBE2M
- Host SpeciesE. coli
- PurificationGreater than 95% as determined by reducing SDS-PAGE.
- SpecificityHuman
- EndotoxinLess than 0.1 ng,μg (1 IEU,μg) as determined by LAL test.
- Accession No. P61081
- UniprotP61081
- Gene ID9040;
- Calculated MW 20.9kDa
- Target Sequence MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK
- Formulation Supplied as a 0.2 μm filtered solution of 50mM HEPES,pH 7.5,2mM DTT,150mM NaCl,10%glycerol .
-
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg,ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. -
Storage Store at < -20C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.