- Product NameRecombinant Human δ(3,5)-δ(2,4)-Dienoyl-CoA Isomerase, Mitochondrial,ECH1
- Host SpeciesE.coli
- PurificationGreater than 95% as determined by reducing SDS-PAGE.
- SpecificityHuman
- EndotoxinLess than 0.1 ng,μg (1 IEU,μg) as determined by LAL test.
- Accession No. Q13011
- UniprotQ13011
- Gene ID1891;
- Calculated MW 34.45kDa
- Target Sequence MGSSHHHHHHSSGLVPRGSHMTGSSAQEEASGVALGEAPDHSYESLRVTSAQKHVLHVQLNRPNKRNAMNKVFWREMVECFNKISRDADCRAVVISGAGKMFTAGIDLMDMASDILQPKGDDVARISWYLRDIITRYQETFNVIERCPKPVIAAVHGGCIGGGVDLVTACDIRYCAQDAFFQVKEVDVGLAADVGTLQRLPKVIGNQSLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLDAALALAAEISSKSPVAVQSTKVNLLYSRDHSVAESLNYVASWNMSMLQTQDLVKSVQATTENKELKTVTFSKL
- Formulation Supplied as a 0.2 μm filtered solution of 20mM Tris,100mM NaCl,10% Glycerol,pH 8.0.
-
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg,ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. -
Storage Store at < -20C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.