- Product NameRecombinant Mouse Fibroblast Growth Factor 9,FGF-9(C-6His)
- Host SpeciesE.coli
- PurificationGreater than 95% as determined by reducing SDS-PAGE.
- SpecificityMouse
- EndotoxinLess than 0.1 ng,μg (1 IEU,μg) as determined by LAL test.
- Accession No. P54130
- UniprotP54130
- Gene ID14180;
- Calculated MW 24.4kDa
- Target Sequence MHHHHHHMAPLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS*
- Formulation Supplied as a 0.2 μm filtered solution of 20mM Tris,150mM NaCl,5%Trehalose,1mM EDTA,20%glycerol1mM DTT,pH8.5 .
-
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg,ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. -
Storage Store at < -20C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
