- Product NameRecombinant Mouse Signal-Regulatory Protein α-1,SIRPA,CD172a (C-6His)
- Host SpeciesHuman Cells
- PurificationGreater than 95% as determined by reducing SDS-PAGE.
- SpecificityMouse
- EndotoxinLess than 0.1 ng,μg (1 IEU,μg) as determined by LAL test.
- Accession No. Q6P6I8
- UniprotQ6P6I8
- Calculated MW 35kDa
- Target Sequence KELKVTQPEKSVSVAAGDSTVLNCTLTSLLPVGPIRWYRGVGPSRLLIYSFAGEYVPRIRNVSDTTKRNNMDFSIRISNVTPADAGIYYCVKFQKGSSEPDTEIQSGGGTEVYVLAKPSPPEVSGPADRGIPDQKVNFTCKSHGFSPRNITLKWFKDGQELHPLETTVNPSGKNVSYNISSTVRVVLNSMDVNSKVICEVAHITLDRSPLRGIANLSNFIRVSPTVKVTQQSPTSMNQVNLTCRAERFYPEDLQLIWLENGNVSRNDTPKNLTKNTDGTYNYTSLFLVNSSAHREDVVFTCQVKHDQQPAITRNHTVLGFAHSSDQGSMQTFPDNNATHNWNHHHHHH
- Formulation Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
-
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg,ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. -
Storage Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20C for 3 months.