- Product NameRecombinant Human Interleukin-4 Receptor Subunit Alpha,IL-4 Rα(C-6His)
- Host SpeciesHuman cells
- PurificationGreater than 95% as determined by reducing SDS-PAGE.
- SpecificityHuman
- EndotoxinLess than 0.1 ng,μg (1 IEU,μg) as determined by LAL test.
- Accession No. P24394
- UniprotP24394
- Gene ID3566;
- Calculated MW 24.4kDa
- Target Sequence MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQHHHHHH
- Formulation Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
-
Storage Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20C for 3 months.
