• Product NameN-terminal GST-tagged
• Species ReactivityHu
• SpecificityE.coli
• Target NameGST-Tag
• Calculated MW 27 Kda
• Tag Info N-terminal GST-tagged
• Target Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPK
• Concentration 0.1-5 mg/ml, by the Bradford Method.
• Formulation Tris-based buffer,50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

•  Greater than 85% as determined by SDS-PAGE.

 GST (Glutathione S-Transferase) is a 26kDa protein which was widely used in the pGEX family of GST plasmid expression vectors as a fusion protein with foreign proteins.GST isoenzymes appear to play a central role in the parasite detoxification system. Other functions are also suspected including a role in increasing the solubility of haematin in the parasite gut.

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting