• Product NameRecombinant Vaccinia virus Protein K3(VACWR034)
• Brief DescriptionRecombinant Protein
• Host SpeciesE.coli
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:1-88aa
  Sequence Info:Full Length
• Alternative Names    Protein K2
• Accession No. P18378
• UniprotP18378
• Gene ID3707649;
• Calculated MW 26.6 kDa
• Tag Info N-terminal 6xHis-SUMO-tagged
• Target Sequence MLAFCYSLPNAGDVIKGRVYEKDYALYIYLFDYPHFEAILAESVKMHMDRYVEYRDKLVGKTVKVKVIRVDYTKGYIDVNYKRMCRHQ
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Viral mimic of eIF-2-alpha that acts as a pseudosubstrate for EIF2AK2,PKR kinase. Inhibits therefore eIF-2-alpha phosphorylation by host EIF2AK2,PKR kinase and prevents protein synthesis shutoff.

"Non-essential genes in the vaccinia virus HindIII K fragment: a gene related to serine protease inhibitors and a gene related to the 37K vaccinia virus major envelope antigen."Boursnell M.E.G., Foulds I.J., Campbell J.I., Binns M.M.J. Gen. Virol. 69:2995-3003(1988)
Research Topic:Others

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting