- Product NameRecombinant Rat Glucagon-like peptide 1 receptor(Glp1r),partial
- Brief DescriptionRecombinant Protein
- Host SpeciesE.coli
- PurificationGreater than 90% as determined by SDS-PAGE.
- Immunogen DescriptionExpression Region:22-135aa
Sequence Info:Partial - Alternative Names Short name: GLP-1 receptor Short name: GLP-1-R Short name: GLP-1R
- Accession No. P32301
- UniprotP32301
- Gene ID25051;
- Calculated MW 17.1 kDa
- Tag Info N-terminal 6xHis-tagged
- Target Sequence GPRPQGATVSLSETVQKWREYRHQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGIWLHKDNSSLPWRDLSECEESKQGERN
- Formulation Tris-based buffer50% glycerol
-
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.
