• Product NameRecombinant Reston ebolavirus Matrix protein VP40(VP40)
• Brief DescriptionRecombinant Protein
• Host SpeciesE.coli
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:1-331aa
  Sequence Info:Full Length
• Alternative Names    Membrane-associated protein VP40
• Accession No. Q8JPX9
• UniprotQ8JPX9
• Gene ID955192;
• Calculated MW 51.8 kDa
• Tag Info N-terminal 6xHis-SUMO-tagged
• Target Sequence MRRGVLPTAPPAYNDIAYPMSILPTRPSVIVNETKSDVLAVPGADVPSNSMRPVADDNIDHSSHTPSGVASAFILEATVNVISGTKVLMKQIPIWLPLGVADQKIYSFDSTTAAIMLASYTVTHFGKISNPLVRVNRLGPGIPDHPLRLLRLGNQAFLQEFVLPPVQLPQYFTFDLTALKLITQPLPAATWTDETPAGAVNALRPGLSLHPKLRPILLPGKTGKKGHASDLTSPDKIQTIMNAIPDLKIVPIDPTKNIVGIEVPELLVQRLTGKKPQPKNGQPIIPVLLPKYVGLDPISPGDLTMVITQDCDSCHSPASHPYHMDKQNSYQ
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Promotes virus assembly and budding by interacting with host proteins of the multivesicular body pathway. May facilitate virus budding by interacting with the nucleocapsid and the plasma membrane. Specific interactions with membrane-associated GP and VP24 during the budding process may also occur. The hexamer form seems to be involved in budding. The octamer form binds RNA, and may play a role in genome replication (By similarity)

"Molecular characterization of an isolate from the 1989,90 epizootic of Ebola virus Reston among macaques imported into the United States." Groseth A., Stroeher U., Theriault S., Feldmann H.Virus Res. 87:155-163(2002)
Research Topic:Others

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting