• Product NameRecombinant Rat Glucagon-like peptide 1 receptor(Glp1r),partial
• Brief DescriptionRecombinant Protein
• Host SpeciesYeast
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:22-135aa
  Sequence Info:Partial
• Accession No. P32301
• UniprotP32301
• Gene ID25051;
• Calculated MW 15.1 kDa
• Tag Info N-terminal 6xHis-tagged
• Target Sequence GPRPQGATVSLSETVQKWREYRHQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGIWLHKDNSSLPWRDLSECEESKQGERN
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.

"Expression cloning of the pancreatic beta cell receptor for the gluco-incretin hormone glucagon-like peptide 1."Thorens B.Proc. Natl.Acad. Sci. U.S.A. 89:8641-8645(1992)
Research Topic:Neuroscience

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting