• Product NameRecombinant Human Heat shock protein beta-2(HSPB2)
• Brief DescriptionRecombinant Protein
• Host SpeciesE.coli
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:1-182aa
  Sequence Info:Full Length
• Alternative Names    DMPK-binding protein
• Accession No. Q16082
• UniprotQ16082
• Gene ID3316;
• Calculated MW 47.2 kDa
• Tag Info N-terminal GST-tagged
• Target Sequence MSGRSVPHAHPATAEYEFANPSRLGEQRFGEGLLPEEILTPTLYHGYYVRPRAAPAGEGSRAGASELRLSEGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRTYVLPADVDPWRVRAALSHDGILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEAAIVEP
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

May regulate the kinase DMPK.

"Identification and characterization of the gene encoding a new member of the alpha-crystallin,small hsp family, closely linked to the alphaB-crystallin gene in a head-to-head manner." Iwaki A., Nagano T., Nakagawa M., Iwaki T., Fukumaki Y. Genomics 45:386-394(1997)
Research Topic:Signal Transduction

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting