• Product NameRecombinant Human Lipopolysaccharide-induced tumor necrosis factor-alpha factor(LITAF)
• Brief DescriptionRecombinant Protein
• Host SpeciesE.coli
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:1-161aa
  Sequence Info:Full Length
• Alternative Names    Small integral membrane protein of lysosome,late endosome p53-induced gene 7 protein
• Accession No. Q99732
• UniprotQ99732
• Gene ID9516;
• Calculated MW 44.1 kDa
• Tag Info N-terminal GST-tagged
• Target Sequence MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKRL
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Probable role in regulating transcription of specific genes. May regulate through NFKB1 the expression of the CCL2,MCP-1 chemokine. May play a role in tumor necrosis factor alpha (TNF-alpha) gene expression.

"A novel lipopolysaccharide-induced transcription factor regulating tumor necrosis factor alpha gene expression: molecular cloning, sequencing, characterization, and chromosomal assignment." Myokai F., Takashiba S., Lebo R., Amar S. Proc. Natl. Acad. Sci. U.S.A. 96:4518-4523(1999)
Research Topic:Signal Transduction

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting