• Product NameRecombinant Human Mitochondrial import inner membrane translocase subunit Tim17-A(TIMM17A)
• Brief DescriptionRecombinant Protein
• Host SpeciesE.coli
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:1-171aa
  Sequence Info:Full Length
• Alternative Names    Inner membrane preprotein translocase Tim17a
• Accession No. Q99595
• UniprotQ99595
• Gene ID10440;
• Calculated MW 45 kDa
• Tag Info N-terminal GST-tagged
• Target Sequence MEEYAREPCPWRIVDDCGGAFTMGTIGGGIFQAIKGFRNSPVGVNHRLRGSLTAIKTRAPQLGGSFAVWGGLFSMIDCSMVQVRGKEDPWNSITSGALTGAILAARNGPVAMVGSAAMGGILLALIEGAGILLTRFASAQFPNGPQFAEDPSQLPSTQLPSSPFGDYRQYQ
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.

"The preprotein translocase of the inner mitochondrial membrane: evolutionary conservation of targeting and assembly of Tim17." Boemer U., Rassow J., Zufall N., Pfanner N., Meijer M., Maarse A.C. J. Mol. Biol. 262:389-395(1996)
Research Topic:Signal Transduction

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting