• Product NameRecombinant Human Hemoglobin subunit zeta(HBZ)
• Brief DescriptionRecombinant Protein
• Host SpeciesE.coli
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:1-142aa
  Sequence Info:Full Length
• Alternative Names    HBAZ Hemoglobin zeta chain Zeta-globin
• Accession No. P02008
• UniprotP02008
• Gene ID3050;
• Calculated MW 42.5 kDa
• Tag Info N-terminal GST-tagged
• Target Sequence SLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGALSKLSELHAYILRVDPVNFKLLSHCLLVTLAARFPADFTAEAHAAWDKFLSVVSSVLTEKYR
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

The zeta chain is an alpha-type chain of mammalian embryonic hemoglobin.

"The structure of the human zeta-globin gene and a closely linked, nearly identical pseudogene." Proudfoot N.J., Gil A., Maniatis T. Cell 31:553-563(1982)
Research Topic:Cardiovascular

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting