• Product NameRecombinant Mouse Insulin-1(Ins1)
• Brief DescriptionRecombinant Protein
• Host SpeciesYeast
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:25-108aa
  Sequence Info:Full Length of Mature Protein
• Accession No. P01325
• UniprotP01325
• Gene ID16333;
• Calculated MW 13 kDa
• Tag Info N-terminal 6xHis-tagged and C-terminal Myc-tagged
• Target Sequence FVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVEDPQVEQLELGGSPGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.

"Positional cloning of Sorcs1, a type 2 diabetes quantitative trait locus." Clee S.M., Yandell B.S., Schueler K.M., Rabaglia M.E., Richards O.C., Raines S.M., Kabara E.A., Klass D.M., Mui E.T.-K., Stapleton D.S., Gray-Keller M.P., Young M.B., Stoehr J.P., Lan H., Boronenkov I., Raess P.W., Flowers M.T., Attie A.D. Nat. Genet. 38:688-693(2006)
Research Topic:Others

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting