- Product NameRecombinant Human Cancer,testis antigen 2(CTAG2)
- Brief DescriptionRecombinant Protein
- Host SpeciesYeast
- PurificationGreater than 85% as determined by SDS-PAGE.
- Immunogen DescriptionExpression Region:1-210aa
Sequence Info:Full Length - Alternative Names Autoimmunogenic cancer,testis antigen NY-ESO-2 Cancer,testis antigen 6.2 Short name: CT6.2 L antigen family member 1 Short name: LAGE-1 ESO2, LAGE1
- Accession No. O75638
- UniprotO75638
- Gene ID30848;
- Calculated MW 34kDa
- Tag Info N-terminal 6xHis-sumostar-tagged
- Target Sequence MQAEGQGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPRGGAPRGPHGGAASAQDGRCPCGARRPDSRLLQLHITMPFSSPMEAELVRRILSRDAAPLPRPGAVLKDFTVSGNLLFMSVRDQDREGAGRMRVVGWGLGSASPEGQKARDLRTPKHKVSEQRPGTPGPPPPEGAQGDGCRGVAFNVMFSAPHI
- Formulation Tris-based buffer50% glycerol
-
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.
