• Product NameRecombinant Human Pulmonary surfactant-associated protein A2(SFTPA2)
• Brief DescriptionRecombinant Protein
• Host SpeciesE.coli
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:141-248aa Sequence Info: partial
• Alternative Names    Collectin-5
• Accession No. Q8IWL1
• UniprotQ8IWL1
• Gene ID729238;
• Calculated MW 30.3 kDa
• Tag Info N-terminal 10xHis-B2M-tagged and C-terminal Myc-tagged
• Target Sequence SNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF
• Formulation 10 mM Tris-HCl, 1 mM EDTA, pH 8.0, 50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

In presence of calcium ions, it binds to surfactant phospholipids and contributes to lower the surface tension at the air-liquid interface in the alveoli of the mammalian lung and is essential for normal respiration.

"Isolation and characterization of cDNA clones for the 35-KDA pulmonary surfactant-associated protein."Floros J., Steinbrink R., Jacobs K., Phelps D., Kriz R., Recny M., Sultzman L., Jones S., Taeusch H.W., Frank H.A., Fritsch E.F.J. Biol. Chem. 261:9029-9033(1986)
Research Topic:Others

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting