• Product NameRecombinant Escherichia coli Large-conductance mechanosensitive channel(mscL)
• Host SpeciesE.coli
• Immunogen DescriptionGreater than 85% as determined by SDS-PAGE.
• Target NamemscL
• Accession No. Uniprot ID: P0A743
• UniprotP0A743
• Gene ID915989;
• Target Species Escherichia coli O157:H7
• Calculated MW 30.95kDa
• Target Length Full Length,1-136aa
• Tag Info N-terminal 6xHis-B2M-tagged
• Target Sequence MSIIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVTLRDAQGDIPAVVMHYGVFIQNVFDFLIVAFAIFMAIKLINKLNRKKEEPAAAPAPTKEEVLLTEIRDLLKEQNNRS
• Formulation Tris-based buffer,50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Channel that opens in response to stretch forces in the membrane lipid bilayer. May participate in the regulation of osmotic pressure changes within the cell (By similarity).

 "Complete genome sequence of enterohemorrhagic Escherichia coli O157:H7 and genomic comparison with a laboratory strain K-12."Hayashi T., Makino K., Ohnishi M., Kurokawa K., Ishii K., Yokoyama K., Han C.-G., Ohtsubo E., Nakayama K., Murata T., Tanaka M., Tobe T., Iida T., Takami H., Honda T., Sasakawa C., Ogasawara N., Yasunaga T.  Shinagawa H.DNA Res. 8:11-22(2001)

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting