• Product NameRecombinant Macaca fascicularis Transthyretin(TTR)
• Host SpeciesMammalian Cell
• Target NameTTR
• Alternative Names    Prealbumin
• Accession No. Uniprot ID: Q8HXW1
• UniprotQ8HXW1
• Gene ID101864775;
• Target Species Mk
• Calculated MW 18.07kDa
• Target Length Full Length,21-147aa
• Tag Info N-terminal 6xHis-tagged
• Target Sequence GPTGVDESKCPLMVKVLDAVRGSPAVNVAVNVFKKAADETWAPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKSLGISPFHEHAEVVFTANDSGPRHYTIAALLSPYSYSTTAVVTNPKE
• Formulation Tris-based buffer,50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

•  Greater than 90% as determined by SDS-PAGE.

 Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain (By similarity).

 "Isolation and characterization of cDNA for macaque neurological disease genes."Kusuda J., Osada N., Hida M., Sugano S., Hashimoto K.

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting