• Product NameRecombinant Human Thymic stromal lymphopoietin(TSLP)
• Brief DescriptionRecombinant Human Thymic stromal lymphopoietin(TSLP)
• Host SpeciesMammalian Cell
• Target NameTSLP
• Accession No. Uniprot ID: Q969D9
• UniprotQ969D9
• Gene ID85480;
• Target Species Hu
• SDS-PAGE MW 18.51kDa
• Target Length Full Length,29-159aa
• Tag Info N-terminal 6xHis-tagged
• Target Sequence YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
• Formulation Tris-based buffer,50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

•  Greater than 90% as determined by SDS-PAGE.

 Isoform 1: Cytokine that induces the release of T-cell-attracting chemokines from monocytes and, in particular, enhances the maturation of CD11c+ dendritic cells. Can induce allergic inflammation by directly activating mast cells.

 "Cloning of human thymic stromal lymphopoietin (TSLP) and signaling mechanisms leading to proliferation."Quentmeier H., Drexler H.G., Fleckenstein D., Zaborski M., Armstrong A., Sims J.E., Lyman S.D.Leukemia 15:1286-1292(2001)

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting