- Product NameRecombinant human Muscarinic acetylcholine receptor M3
- Brief DescriptionRecombinant human Muscarinic acetylcholine receptor M3
- Host SpeciesE.coli
- PurificationGreater than 90% as determined by SDS-PAGE.
- Target NameCHRM3
- Accession No. Swiss-Prot#:P20309
- UniprotP20309
- Gene ID1131;
- Calculated MW 40.7 kDa
- Tag Info N-terminal 6xHis-B2M-tagged
- Target Sequence RIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSMKRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSETRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSFPKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKRMSLVKEKKAAQT
- Formulation Tris-based buffer50% glycerol
-
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.
