• Product NameRecombinant Zaire ebolavirus (strain Kikwit-95) (ZEBOV) (Zaire Ebola virus) Matrix protein VP40
• Brief DescriptionRecombinant Protein
• Host SpeciesE.coli
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:1-326AA
  Sequence Info:Full Length
• Alternative Names    Membrane-associated protein VP40
• Accession No. Q77DJ6
• UniprotQ05128
• Gene ID911825;
• Calculated MW 51.2 kDa
• Tag Info N-terminal 6xHis-SUMO-tagged
• Target Sequence MRRVILPTAPPEYMEAIYPVRSNSTIARGGNSNTGFLTPESVNGDTPSNPLRPIADDTIDHASHTPGSVSSAFILEAMVNVISGPKVLMKQIPIWLPLGVADQKTYSFDSTTAAIMLASYTITHFGKATNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQEFVLPPVQLPQYFTFDLTALKLITQPLPAATWTDDTPTGSNGALRPGISFHPKLRPILLPNKSGKKGNSADLTSPEKIQAIMTSLQDFKIVPIDPTKNIMGIEVPETLVHKLTGKKVTSKNGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPASLPAVIEK
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Promotes virus assbly and budding by interacting with host proteins of the multivesicular body pathway. May facilitate virus budding by interacting with the nucleocapsid and the plasma mbrane. Specific interactions with mbrane-associated GP and VP24 during the budding process may also occur. The hexamer form ses to be involved in budding. The octamer form binds RNA, and may play a role in genome replication .

Chain P.S.G., Ichou M.A., Malfatti S.A., Hajjaj A., Vergez L.M., Paragas J., Do L.H., Jahrling P.B., Smith K.L., McCready P.M., Ibrahim M.S.Crystal structure of the matrix protein VP40 from Ebola virus.Dessen A., Volchkov V., Dolnik O., Klenk H.-D., Weissenhorn W.EMBO J. 19:4228-4236(2000)
Research Topic:Others

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting