- Product NameRecombinant human C-type lectin domain family 4 member D
- Brief DescriptionRecombinant Protein
- Host SpeciesE.coli
- PurificationGreater than 90% as determined by SDS-PAGE.
- Immunogen DescriptionExpression Region:39-215aa
Sequence Info:Extracellular Domain - Alternative Names C-type lectin superfamily member -type lectin-like receptor 6 ;CLEC-6
- Accession No. Q8WXI8
- UniprotQ8WXI8
- Gene ID338339;
- Calculated MW 36.7 kDa
- Tag Info N-terminal 6xHis-SUMO-tagged
- Target Sequence CLVTHHNFSRCKRGTGVHKLEHHAKLKCIKEKSELKSAEGSTWNCCPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLDRRLSYFLGLRDENAKGQWRWVDQTPFNPRRVFWHKNEPDNSQGENCVVLVYNQDKWAWNDVPCNFEASRICKIPGTTLN
- Formulation Tris-based buffer50% glycerol
-
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.
