- Product NameRecombinant human DAN domain family member 5
- Brief DescriptionRecombinant Protein
- Host SpeciesE.coli
- PurificationGreater than 90% as determined by SDS-PAGE.
- Immunogen DescriptionExpression Region:23-189aa
Sequence Info:Full Length - Alternative Names Cerberus-like protein 2 ;Cerl-2;Cysteine knot superfamily 1, BMP antagonist 3Gremlin-3
- Accession No. Q8N907
- UniprotQ8N907
- Gene ID199699;
- Calculated MW 34.1 kDa
- Tag Info N-terminal 6xHis-SUMO-tagged
- Target Sequence RPEPQSPRPQSWAAANQTWALGPGALPPLVPASALGSWKAFLGLQKARQLGMGRLQRGQDEVAAVTLPLNPQEVIQGMCKAVPFVQVFSRPGCSAIRLRNHLCFGHCSSLYIPGSDPTPLVLCNSCMPARKRWAPVVLWCLTGSSASRRRVKISTMLIEGCHCSPKA
- Formulation Tris-based buffer50% glycerol
-
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.