• Product NameRecombinant human C-type lectin domain family 4 member C
• Brief DescriptionRecombinant Protein
• Host SpeciesE.coli
• PurificationGreater than 90% as determined by SDS-PAGE.
• Biological ActivityMeasured by its binding ability in a functional ELISA. Immobilized CLEC4C protein at 1 g,ml can bind human IgG, the EC50 of human IgG is 31.43-43.52 g,ml.
• Immunogen DescriptionExpression Region:45-213aa
  Sequence Info:Extracellular Domain
• Alternative Names    Blood dendritic cell antigen 2 ;BDCA-2;C-type lectin superfamily member 7Dendritic lectin; CD303
• Accession No. Q8WTT0
• UniprotQ8WTT0
• Gene ID170482;
• Calculated MW 36 kDa
• Tag Info N-terminal 6xHis-SUMO-tagged
• Target Sequence NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Involved in antigen-capturing. Target ligand into antigen processing and peptide-loading compartments for presentation to T-cells. May mediate potent inhibition of induction of IFN-alpha,beta expression in plasmacytoid dendritic cells. May act as a signaling receptor that activates protein-tyrosine kinases and mobilizes intracellular calcium. Does not se to bind mannose.

Molecular and genomic characterization of human DLEC, a novel member of the C-type lectin receptor gene family preferentially expressed on monocyte-derived dendritic cells.Arce I., Roda-Navarro P., Montoya M.C., Hernanz-Falcon P., Puig-Kroger A., Fernandez-Ruiz E.3.0.CO;2-X>Eur. J. Immunol. 31:2733-2740(2001)
Research Topic:Immunology

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting