- Product NameRecombinant human 17-beta-hydroxysteroid dehydrogenase 14
- Brief DescriptionRecombinant Protein
- Host SpeciesE.coli
- PurificationGreater than 90% as determined by SDS-PAGE.
- Immunogen DescriptionExpression Region:1-270aa
Sequence Info:Full Length - Alternative Names 17-beta-hydroxysteroid dehydrogenase DHRS10Dehydrogenase,reductase SDR family member 10Retinal short-chain dehydrogenase,reductase retSDR3Short chain dehydrogenase,reductase family 47C member 1
- Accession No. Q9BPX1
- UniprotQ9BPX1
- Gene ID51171;
- Calculated MW 44.3 kDa
- Tag Info N-terminal 6xHis-SUMO-tagged
- Target Sequence MATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIPS
- Formulation Tris-based buffer50% glycerol
-
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.
