- Product NameRecombinant mouse Serine protease 29
- Brief DescriptionRecombinant Protein
- Host SpeciesE.coli
- PurificationGreater than 85% as determined by SDS-PAGE.
- Immunogen DescriptionExpression Region:18-279aa
Sequence Info:Full Length - Alternative Names Implantation serine proteinase 2 Isp2
- Accession No. Q99MS4
- UniprotQ99MS4
- Gene ID114662;
- Calculated MW 45.1 kDa
- Tag Info N-terminal 6xHis-SUMO-tagged
- Target Sequence GTPAPGPEDVLMGIVGGHSAPQGKWPWQVSLRIYRYYWAFWVHNCGGSIIHPQWVLTAAHCIRERDADPSVFRIRVGEAYLYGGKELLSVSRVIIHPDFVHAGLGSDVALLQLAVSVQSFPNVKPVKLPSESLEVTKKDVCWVTGWGAVSTHRSLPPPYRLQQVQVKIIDNSLCEEMYHNATRHRNRGQKLILKDMLCAGNQGQDSCYGDSGGPLVCNVTGSWTLVGVVSWGYGCALRDFPGVYARVQSFLPWITQQMQRFS
- Formulation Tris-based buffer50% glycerol
-
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.
