• Product NameRecombinant human 3-hydroxyacyl-CoA dehydrogenase type-2
• Brief DescriptionRecombinant Protein
• Host SpeciesE.coli
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:2-261aa
  Sequence Info:Full Length
• Alternative Names    17-beta-hydroxysteroid dehydrogenase 10 (EC:1.1.1.51) ;17-beta-HSD 103-hydroxy-2-methylbutyryl-CoA dehydrogenase (EC:1.1.1.178)3-hydroxyacyl-CoA dehydrogenase type IIEndoplasmic reticulum-associated amyloid beta-peptide-binding protein;Mitochondrial ribonuclease P protein 2 ;Mitochondrial RNase P protein 2Short chain dehydrogenase,reductase family 5C member 1Short-chain type dehydrogenase,reductase XH98G2Type II HADH
• Accession No. Q99714
• UniprotQ99714
• Gene ID3028;
• Calculated MW 42.8 kDa
• Tag Info N-terminal 6xHis-SUMO-tagged
• Target Sequence AAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Functions in mitochondrial tRNA maturation. Part of mitochondrial ribonuclease P, an enzyme composed of MRPP1,TRMT10C, MRPP2,HSD17B10 and MRPP3,KIAA0391, which cleaves tRNA molecules in their 5'-ends. Catalyzes the beta-oxidation at position 17 of androgens and estrogens and has 3-alpha-hydroxysteroid dehydrogenase activity with androsterone. Catalyzes the third step in the beta-oxidation of fatty acids. Carries out oxidative conversions of 7-alpha-OH and 7-beta-OH bile acids. Also exhibits 20-beta-OH and 21-OH dehydrogenase activities with C21 steroids. By interacting with intracellular amyloid-beta, it may contribute to the neuronal dysfunction associated with Alzheimer disease (AD).

An intracellular protein that binds amyloid-beta peptide and mediates neurotoxicity in Alzheimer's disease.Yan S.D., Fu J., Soto C., Chen X., Zhu H., Al-Mohanna F., Collinson K., Zhu A., Stern E., Saido T., Tohyama M., Ogawa S., Roher A., Stern D.Nature 389:689-695(1997)
Research Topic:Transcription

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting