• Product NameRecombinant human Zinc finger matrin-type protein 5
• Brief DescriptionRecombinant Protein
• Host SpeciesE.coli
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:1-170aa
  Sequence Info:Full Length
• Alternative Names    U11,U12 small nuclear ribonucleoprotein 20KDA protein ;U11,U12 snRNP 20KDA protein ;U11,U12-20K
• Accession No. Q9UDW3
• UniprotQ9UDW3
• Gene ID55954;
• Calculated MW 36 kDa
• Tag Info N-terminal 6xHis-SUMO-tagged
• Target Sequence MGKRYFCDYCDRSFQDNLHNRKKHLNGLQHLKAKKVWYDMFRDAAAILLDEQNKRPCRKFLLTGQCDFGSNCRFSHMSERDLQELSIQVEEERRAREWLLDAPELPEGHLEDWLEKRAKRLSSAPSSRAEPIRTTVFQYPVGWPPVQELPPSLRAPPPGGWPLQPRVQWG
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

0

Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201).Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.A genome annotation-driven approach to cloning the human ORFeome.Collins J.E., Wright C.L., Edwards C.A., Davis M.P., Grinham J.A., Cole C.G., Goward M.E., Aguado B., Mallya M., Mokrab Y., Huckle E.J., Beare D.M., Dunham I.Genome Biol. 5:R84.1-R84.11(2004)
Research Topic:Epigenetics and Nuclear Signaling

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting