• Product NameRecombinant human Mitochondrial peptide methionine sulfoxide reductase isoform a
• Brief DescriptionRecombinant Protein
• Host SpeciesE.coli
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:24-235aa
  Sequence Info:Full Length
• Alternative Names    Peptide-methionine (S)-S-oxide reductase ;Peptide Met(O) reductaseProtein-methionine-S-oxide reductase ;PMSR
• Accession No. Q9UJ68
• UniprotQ9UJ68
• Gene ID4482;
• Calculated MW 27.5 kDa
• Tag Info N-terminal 6xHis-tagged
• Target Sequence GNSASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVFWENHDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIKK
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine.

Gene structure, localization and role in oxidative stress of methionine sulfoxide reductase A (MSRA) in the monkey retina.Lee J.W., Gordiyenko N.V., Marchetti M., Tserentsoodol N., Sagher D., Alam S., Weissbach H., Kantorow M., Rodriguez I.R.Exp. Eye Res. 82:816-827(2006)
Research Topic:Metabolism

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting