- Product NameRecombinant human Complement C1q tumor necrosis factor-related protein 3
- Brief DescriptionRecombinant Protein
- Host SpeciesE.coli
- PurificationGreater than 90% as determined by SDS-PAGE.
- Immunogen DescriptionExpression Region:23-246aa
Sequence Info:Full Length - Alternative Names Collagenous repeat-containing sequence 26KDA protein ;CORS26Secretory protein CORS26
- Accession No. Q9BXJ4
- UniprotQ9BXJ4
- Gene ID114899;
- Calculated MW 28.2 kDa
- Tag Info N-terminal 6xHis-tagged
- Target Sequence QDEYMESPQTGGLPPDCSKCCHGDYSFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGIPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEMKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK
- Formulation Tris-based buffer50% glycerol
-
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.
