• Product NameRecombinant Human Mitochondrial import inner membrane translocase subunit Tim10 B
• Brief DescriptionRecombinant Protein
• Host SpeciesE.coli
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:1-103aa
  Sequence Info:Full Length
• Alternative Names    Fracture callus protein 1FxC1Mitochondrial import inner membrane translocase subunit Tim9 BTIMM10B ;Tim10b
• Accession No. Q9Y5J6
• UniprotQ9Y5J6
• Gene ID26515;
• Calculated MW 27.6 kDa
• Tag Info N-terminal 6xHis-SUMO-tagged
• Target Sequence MERQQQQQQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVQLMPALVQRRIADYEAASAVPGVAAEQPGVSPSGS
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Component of the TIM22 complex, a complex that mediates the import and insertion of multi-pass transmbrane proteins into the mitochondrial inner mbrane. The TIM22 complex forms a twin-pore translocase that uses the mbrane potential as the external driving force. In the TIM22 complex, it may act as a docking point for the soluble 70KDA complex that guides the target proteins in transit through the aqueous mitochondrial intermbrane space.

Organization and function of the small Tim complexes acting along the import pathway of metabolite carriers into mammalian mitochondria.Muehlenbein N., Hofmann S., Rothbauer U., Bauer M.F.J. Biol. Chem. 279:13540-13546(2004)
Research Topic:Signal Transduction

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting