• Product NameRecombinant human Calmodulin-like protein 5
• Brief DescriptionRecombinant Protein
• Host SpeciesE.coli
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:2-146aa
  Sequence Info:Full Length
• Alternative Names    Calmodulin-like skin protein
• Accession No. Q9NZT1
• UniprotQ9NZT1
• Gene ID51806;
• Calculated MW 31.8 kDa
• Tag Info N-terminal 6xHis-SUMO-tagged
• Target Sequence AGELTPEEEAQYKKAFSAVDTDGNGTINAQELGAALKATGKNLSEAQLRKLISEVDSDGDGEISFQEFLTAAKKARAGLEDLQVAFRAFDQDGDGHITVDELRRAMAGLGQPLPQEELDAMIREADVDQDGRVNYEEFARMLAQE
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Binds calcium. May be involved in terminal differentiation of keratinocytes.

Identification and cloning of a new calmodulin-like protein from human epidermis.Mehul B., Bernard D., Simonetti L., Bernard M.A., Schmidt R.J. Biol. Chem. 275:12841-12847(2000)
Research Topic:Cell Biology

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting