• Product NameRecombinant human Cystatin-B protein
• Brief DescriptionRecombinant Protein
• Host SpeciesE.coli
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:1-98aa
  Sequence Info:Full Length
• Alternative Names    CPI-BLiver thiol proteinase inhibitorStefin-B
• Accession No. P04080
• UniprotP04080
• Gene ID1476;
• Calculated MW 38.1 kDa
• Tag Info N-terminal GST-tagged
• Target Sequence MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

This is an intracellular thiol proteinase inhibitor. Tightly binding reversible inhibitor of cathepsins L, H and B.

Amino acid sequence of the intracellular cysteine proteinase inhibitor cystatin B from human liver.Ritonja A., Machleidt W., Barrett A.J.Biochem. Biophys. Res. Commun. 131:1187-1192(1985)
Research Topic:Cell Biology

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting