• Product NameRecombinant human Diamine acetyltransferase 1
• Brief DescriptionRecombinant Protein
• Host SpeciesE.coli
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:5-171aa?
  Sequence Info:Full Length
• Alternative Names    Polyamine N-acetyltransferase 1;Putrescine acetyltransferase;Spermidine,spermine N(1)-acetyltransferase 1 ;SSAT ;SSAT-1
• Accession No. P21673
• UniprotP21673
• Gene ID6303;
• Calculated MW 46.5 kDa
• Tag Info N-terminal GST-tagged
• Target Sequence VIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Enzyme which catalyzes the acetylation of polyamines. Substrate specificity: norspermidine = spermidine >> spermine > N(1)-acetylspermine > putrescine. This highly regulated enzyme allows a fine attenuation of the intracellular concentration of polyamines. Also involved in the regulation of polyamine transport out of cells. Acts on 1,3-diaminopropane, 1,5-diaminopentane, putrescine, spermidine (forming N(1)- and N(8)-acetylspermidine), spermine, N(1)-acetylspermidine and N(8)-acetylspermidine.

Isolation and characterization of a cDNA clone that codes for human spermidine,spermine N1-acetyltransferase.Casero R.A. Jr., Celano P., Ervin S.J., Applegren N.B., Wiest L., Pegg A.E.J. Biol. Chem. 266:810-814(1991)
Research Topic:Metabolism

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting