• Product NameRecombinant human Dr1-associated corepressor protein
• Brief DescriptionRecombinant Protein
• Host SpeciesE.coli
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:4-198aa
  Sequence Info:Partial
• Alternative Names    Dr1-associated protein 1Negative cofactor 2-alpha ;NC2-alpha
• Accession No. Q14919
• UniprotQ14919
• Gene ID10589;
• Calculated MW 48.2 kDa
• Tag Info N-terminal GST-tagged
• Target Sequence KKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHLKQCIELEQQFDFLKDLVASVPDMQGDGEDNHMDGDKGARRGRKPGSGGRKNGGMGTKSKDKKLSGTDSEQEDESEDTDTDGEEETSQPPPQASHPSAHFQSPPTPFLPFASTLPLPPAPPGPSAPDEE
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

The association of the DR1,DRAP1 heterodimer with TBP results in a functional repression of both activated and basal transcription of class II genes. This interaction precludes the formation of a transcription-competent complex by inhibiting the association of TFIIA and,or TFIIB with TBP. Can bind to DNA on its own.

NC2alpha interacts with BTAF1 and stimulates its ATP-dependent association with TATA-binding protein.Klejman M.P., Pereira L.A., van Zeeburg H.J.T., Gilfillan S., Meisterernst M., Timmers H.T.M.Mol. Cell. Biol. 24:10072-10082(2004)
Research Topic:Transcription

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting