- Product NameRecombinant human Myosin light polypeptide 6 protein
- Brief DescriptionRecombinant Protein
- Host SpeciesE.coli
- PurificationGreater than 90% as determined by SDS-PAGE.
- Immunogen DescriptionExpression Region:3-151aa
Sequence Info:Partial - Alternative Names 17KDA myosin light chain ;LC17Myosin light chain 3 ;MLC-3Myosin light chain alkali 3 ;Myosin light chain A3Smooth muscle and nonmuscle myosin light chain alkali 6
- Accession No. P60660
- UniprotP60660
- Gene ID4637;
- Calculated MW 43.7 kDa
- Tag Info N-terminal GST-tagged
- Target Sequence DFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCINYEAFVRHILSG
- Formulation Tris-based buffer50% glycerol
-
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.