• Product NameRecombinant human Interferon beta protein
• Brief DescriptionRecombinant Protein
• Host SpeciesE.coli
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:22-187aa
  Sequence Info:Full Length
• Alternative Names    Fibroblast interferon
• Accession No. P01574
• UniprotP01574
• Gene ID3456;
• Calculated MW 47 kDa
• Tag Info N-terminal GST-tagged
• Target Sequence MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Has antiviral, antibacterial and anticancer activities.

Livingston R.J., Shaffer T., McFarland I., Nguyen C.P., Stanaway I.B., Rajkumar N., Johnson E.J., da Ponte S.H., Willa H., Ahearn M.O., Bertucci C., Acklestad J., Carroll A., Swanson J., Gildersleeve H.I., Nickerson D.A.Human protein factory for converting the transcriptome into an in vitro-expressed proteome.Goshima N., Kawamura Y., Fukumoto A., Miura A., Honma R., Satoh R., Wakamatsu A., Yamamoto J., Kimura K., Nishikawa T., Andoh T., Iida Y., Ishikawa K., Ito E., Kagawa N., Kaminaga C., Kanehori K., Kawakami B. , Kenmochi K., Kimura R., Kobayashi M., Kuroita T., Kuwayama H., Maruyama Y., Matsuo K., Minami K., Mitsubori M., Mori M., Morishita R., Murase A., Nishikawa A., Nishikawa S., Okamoto T., Sakagami N., Sakamoto Y., Sasaki Y., Seki T., Sono S., Sugiyama A., Sumiya T., Takayama T., Takayama Y., Takeda H., Togashi T., Yahata K., Yamada H., Yanagisawa Y., Endo Y., Imamoto F., Kisu Y., Tanaka S., Isogai T., Imai J., Watanabe S., Nomura N.Nat. Methods 5:1011-1017(2008)
Research Topic:Immunology

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting