• Product NameRecombinant human Interleukin-10 proyein
• Brief DescriptionRecombinant Protein
• Host SpeciesE.coli
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:19-178aa
  Sequence Info:Full Length
• Alternative Names    Cytokine synthesis inhibitory factor ;CSIF
• Accession No. P22301
• UniprotP22301
• Gene ID3586;
• Calculated MW 45.6 kDa
• Tag Info N-terminal GST-tagged
• Target Sequence SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells.

A Gly15Arg mutation in the interleukin-10 gene reduces secretion of interleukin-10 in Crohn disease.van der Linde K., Boor P.P., Sandkuijl L.A., Meijssen M.A., Savelkoul H.F., Wilson J.H., de Rooij F.W.Scand. J. Gastroenterol. 38:611-617(2003)
Research Topic:Immunology

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting