• Product NameRecombinant human Tumor necrosis factor ligand superfamily member 9 protein
• Brief DescriptionRecombinant Protein
• Host SpeciesE.coli
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:52-254aa
  Sequence Info:Partial
• Alternative Names    4-1BB ligand receptorCDw137T-cell antigen 4-1BB homologT-cell antigen ILA; CD137
• Accession No. P41273
• UniprotP41273
• Gene ID8744;
• Calculated MW 25.3 kDa
• Tag Info N-terminal 6xHis-tagged
• Target Sequence PWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Receptor for TNFSF9,4-1BBL. Possibly active during T cell activation.

Molecular and biological characterization of human 4-1BB and its ligand.Alderson M.R., Smith C.A., Tough T.W., Davis-Smith T., Armitage R.J., Falk B., Roux E., Baker E., Sutherland G.R., Din W.S., Goodwin R.G.Eur. J. Immunol. 24:2219-2227(1994)
Research Topic:Immunology

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting