• Product NameRecombinant human Platelet basic protein
• Brief DescriptionRecombinant Protein
• Host SpeciesE.coli
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:59-125aa
  Sequence Info:Partial
• Alternative Names    C-X-C motif chemokine 7Leukocyte-derived growth factor ;LDGFMacrophage-derived growth factor ;MDGFSmall-inducible cytokine B7
• Accession No. P02775
• UniprotP02775
• Gene ID5473;
• Calculated MW 34.4 kDa
• Tag Info N-terminal GST-tagged
• Target Sequence AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDE
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

LA-PF4 stimulates DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by human synovial cells. NAP-2 is a ligand for CXCR1 and CXCR2, and NAP-2, NAP-2(73), NAP-2(74), NAP-2(1-66), and most potent NAP-2(1-63) are choattractants and activators for neutrophils. TC-1 and TC-2 are antibacterial proteins, in vitro released from activated platelet alpha-granules. CTAP-III(1-81) is more potent than CTAP-III desensitize chokine-induced neutrophil activation.

Cloning of cDNA coding for connective tissue activating peptide III from a human platelet-derived lambda gt11 expression library.Wenger R.H., Wicki A.N., Walz A., Kieffer N., Clemetson K.J.Blood 73:1498-1503(1989)
Research Topic:Immunology

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting