• Product NameRecombinant mouse Growth-regulated alpha protein
• Brief DescriptionRecombinant Protein
• Host SpeciesE.coli
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:29-96aa
  Sequence Info:Partial
• Alternative Names    C-X-C motif chemokine 1;Platelet-derived growth factor-inducible protein KCSecretory protein N51
• Accession No. P12850
• UniprotP12850
• Gene ID14825;
• Calculated MW 11.5 kDa
• Tag Info N-terminal 6xHis-tagged
• Target Sequence NELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Has chotactic activity for neutrophils. Contributes to neutrophil activation during inflammation . Hatoregulatory chokine, which, in vitro, suppresses hatopoietic progenitor cell proliferation. KC(5-72) shows a highly enhanced hatopoietic activity.1 Publication

The platelet-derived growth factor-inducible KC gene encodes a secretory protein related to platelet alpha-granule proteins.Oquendo P., Alberta J., Wen D., Graycar J.L., Derynck R., Stiles C.D.J. Biol. Chem. 264:4133-4137(1989)
Research Topic:Others

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting