• Product NameRecombinant mouse C-X-C motif chemokine 2 protein
• Brief DescriptionRecombinant Protein
• Host SpeciesE.coli
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:28-100aa
  Sequence Info:Full Length
• Alternative Names    Macrophage inflammatory protein 2 ;MIP2
• Accession No. P10889
• UniprotP10889
• Gene ID20310;
• Calculated MW 11.8 kDa
• Tag Info N-terminal 6xHis-tagged
• Target Sequence AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Chotactic for human polymorphonuclear leukocytes but does not induce chokinesis or an oxidative burst.

Cloning and characterization of cDNAs for murine macrophage inflammatory protein 2 and its human homologues.Tekamp-Olson P., Gallegos C., Bauer D., McClain J., Sherry B., Fabre M., van Deventer S., Cerami A.J. Exp. Med. 172:911-919(1990)
Research Topic:Others

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting